Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala |
Lysenin-2 |
GWKIGKKLEHMGQNIRDGLISAGPAVFAVGQAATIYAAAK |
||
Lysenin is a protein of 297 amino acids purified from coelomic fluid of the earthworm Eisenia foetida. An older designation for Lysenin-3 is Fetidin
Lysenin is a defense protein expressed in the large intestinal coelomocytes and in the free large chloragocytes (Ohta et al, 2000).
Yamaji et al (1998) have identified Lysenin as a sphingomyelin-specific binding protein. The cDNA has been cloned by Sekizawa et al (1997). The protein is hemolytic for erythrocytes and highly toxic for vertebrates but not invertebrates
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |