LTP-1 peptide |
LTR activity |
KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF |
||
This targeting peptide has been isolated by phage display library screening as a peptide that recognizes clear cell carcinoma, an aggressive subtype of epithelial ovarian cancer (Shen et al, 2015). Peptide-conjugated nanoparticles loaded with the anticancer drug doxorubicin demonstrate better tumor endocytosis and time-dependent gradual increase of intracellular drug uptake than non-targeting liposomal nanoparticles.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |