LEAP-1 |
LEAP-2A |
M2-activated microglia |
||
[liver-expressed antimicrobial peptide-2; liver enriched antimicrobial peptide 2] This peptide (MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE), which is expressed predominantly in the liver, has been identified by Krause et al (2003) in human blood ultrafiltrate. LEAP-2 exists in several circulating forms that differ in their amino-terminal lengths. LEAP-2 is synthesized as a precursor of 77 amino acids that is highly conserved among mammals. Mature human and mouse LEAP2 (amino acids 38-77) are identical. An alternative promoter directs the synthesis of at least four different splice variants
Howard et al (2010) have reported the expression of secreted and intracellular LEAP-2 splice variants in human gastrointestinal epithelial tissues and THP-1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |