KRS |
KRS2 |
PLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDP |
||
[Kinase responsive to stress-1] see: STK3 [serine/threonine kinase 3]
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |