Immunosuppressive factor |
Immunotransmitters |
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY |
||
[immunotoxins]
General term for cytotoxic proteins generated by covalent linkage of an antibody to a cytocidal toxin protein. Specific binding to target cells is effected by the antibody moiety of this hybrid protein while the toxin portion is used to specifically inactivate the target cells (cancer cells, cells mediating autoimmune disease).
For special constructs see also: Mitotoxins, saporin, Cytokine fusion toxins, Antibody fusion proteins, immunocasp-3, Immunocasp-6, ImmunoGrB.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |