HIM |
HIMS-defensin |
casein-beta(140-143) |
||
This putative antimicrobial peptide has been identified in histone H2A of Round Whip Ray, Himantura pastinacoides. Its sequence, KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL, shows high similarity to other antimicrobial peptides derived from histone H2A (Sathyan et al, 2012). For bioactive fragments of histone proteins see also: HDAPs [Histone-derived antimicrobial peptides].
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |