HNA4a |
HNGEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT |
WAP 4-disulfide core domain 1 |
||
[human neutrophil antigen 5a] This is another designation (Bux et al, 1999, 2002) for a leukocyte antigen formerly known as OND or OND(a) (Simsek et al, 1996). It is one of the polymorphic forms of CD11a (LFA-1), which is expressed on all leukocytes (granulocytes, monocytes, T-cells, B-cells) (Simsek et al, 1996).
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |