HMG2(17-48) |
HMGA2 |
LRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
||
For this bioactive fragment of HMGN2 [high mobility group nucleosomal binding protein 2] (which is identical with HMG17) see: IIF-2 [tumor invasion-inhibiting factor-2; Invasion-inhibiting factor-2].
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |