HIMF |
HIN-2 |
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
||
[high in normal-1] HIN-1 has been identified as a gene the expression of which is downregulated significantly in >90 % of human breast carcinomas and preinvasive lesions. HIN-1 is a secreted protein highly expressed in normal breast epithelium and downregulated in breast carcinomas.
The authors describe HIN-1 as a putative cytokine with no significant homology to known proteins. HIN-1 inhibits cell growth of into breast cancer cells engineered to produce the protein.
The protein is related to uteroglobin and has been referred to as UGRP2 [Uteroglobin-related protein 2] by Niimi et al (2002), who cloned the murine gene (For a related protein see also
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |