HGP43 |
HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT |
ALWKSLLKNVGVAAGKAALNAVTDMVNQ |
||
HGP92 is a glycoprotein of 92 kDa isolated from human urine. Sequence analysis of tryptic peptides show that it is identical with Uromodulin (Fontan et al, 1995). Injected intravenously, HGP92 protects mice and SCID mice (Fontan et al, 1994) against a lethal inoculum of Listeria monocytogenes. HGP92 rapidly and significantly enhances the level of cytokine mRNA for IL1-alpha, IL1-beta, IL6, IL10, IL12, TNF-alpha. and GM-CSF in macrophages and monocytes. The effect is comparable to treatment with LPS.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |