hGC-1 |
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
chicken embryonic kinase 6 |
||
This biochemically uncharacterized factor of 20 kDa is produced by human gingival epithelial cells (HGE). The factor stimulates the production of collagenase by periodontal ligament fibroblasts or gingival fibroblasts. The activity is markedly inhibited by antibodies against IL1-alpha (see: IL1).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |