H1 relaxin |
H1 targeting peptide |
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT |
||
This long non-coding RNA (340 nucleotides) is encoded by the RPPH1 [ribonuclease P RNA component H1] gene and is transcribed by RNA polymerase III and RNA Polymerase II (James Farese et al, 2012). H1 RNA has been shown to be the RNA component of a ribonucleoprotein complex consisting of at least ten different proteins and known as RNase P (Bartkiewicz et al, 1989). This endoribonuclease is structurally and functionally related to RNase MRP and shares many protein subunits with RNase P (Welting et al, 2006).
Human nuclear RNase P is a tRNA processing ribonucleoprotein that requires H1 RNA to recognise precursor tRNA
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |