Galig |
Galleria mellonella protein-24 |
QTFQYSRGWTNamide |
||
This protein (DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE) has been purified from the larval haemolymph of the wax moth Galleria mellonella immunized against Escherichia coli (Lee et al, 2004). The peptide is related to defensins and contains six cysteine residues that may be engaged in intramolecular disulfide bridges. Galleria defensin shares about 90.7 % identity to heliomicin. The gene encoding Galleria defensin is expressed in the fat body and in the midgut.
Palusińska-Szysz et al (2012) have reported that Galleria defensin is active against Legionella dumoffii, one etiological agent of Legionnaires' disease.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |