GVSKVKEAMAPKHKEMPFPKYPVEPFTESQ |
GVVDECCIQPCTLDVLATYC |
heat shock protein 108 |
||
This peptide, Gly-Val-Ser-Leu-Leu-Gln-Gln-Phe-Phe-Leu, has been isolated from enzymatic hydrolysates of Mytilus coruscus. The peptide has anti-inflammatory activity and effectively inhibits nitric oxide production by macrophages.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |