GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR |
GREAT |
Thyroxine-binding prealbumin |
||
[Glucocorticoid response element] A short sequence region (TGTTCT) found in the promoter of some genes, including some cytokine genes such as IL6, IL8, the expression of which is subject to regulation by glucocorticoids. This sequence element is the binding site for regulatory proteins (glucocorticoid receptor and other regulatory proteins) that influence transcription (see also: gene expression, Response elements).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |