GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
GIKCCFCCGCCNSGVCELCCRF |
low density lipoprotein receptor-related protein 5 |
||
This peptide corresponds to a bioactive fragment of Ovalbumin.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |