GETFDKLKEKLKTFYQKLVEKAEDLKGDLKAKLS |
GF |
CFWTSCPIGamide |
||
This peptide has been obtained from Nile tilapia (Oreochromis niloticus) skin gelatin by trypsin digestion (Choonpicharn S et al, 2016). The peptide shows antioxidant activity and inhibits ACE [angiotensin-converting enzyme; angiotensin-1 converting enzyme].
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |