GAS2L1 |
GAS2L3 |
QVLKYCPKIGYCSSKCSKAEVWAYSPDCKVHCCVPANQKW |
||
[Growth arrest-specific gene-2-like-2] The gene encoding this protein has been identified by Goriounov D et al (2003) on the basis of sequence homology to GAR22 [GAS2-related protein on chromosome 22] (see: GAS2L1 [Growth arrest-specific gene-2-like-1]). The protein, termed GAR17 [GAS2-related protein on chromosome 17] by the authors, is most related to gas-2 (see also: gas genes) and yields two isoforms termed GAR17-alpha and GAR17-beta. GAR17 expression appears to be restricted skeletal muscle, and the protein, like GAR22
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |