FRKKWNKWALSR |
FRL1 |
ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ |
||
[Fibroblast growth factor receptor ligand] FRL1 and FRL2 are two secreted proteins from Xenopus laevis that activate the fibroblast growth factor (FGF) receptor in Xenopus laevis oocytes as well as in yeast. FRL2 binds directly to the receptor domain of the FGF receptor.
FRL1 shows highest homology with Cripto, a mouse member of the EGF family of proteins and is considered the frog homolog of cripto. It is related also to Cryptic
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |