FLAME-1 |
FLamides |
ISDYSIRMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
||
[FADD-like anti-apoptotic molecule-3] This nuclear protein contains a death effector domain. FLAME-3 shares significant sequence (46.6 % identity) and structural homology with DEDD. FLAME-3 interacts with DEDD and FLIP (FLAME-1) but not with the other proteins with a death effector domain, FADD, caspase-8 or caspase-10. The TFIIIC102 subunit of human transcription factor TFIIIC has been identified as a protein interacting specifically with FLAME-3. The approved gene symbol is DEDD2.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |