fasting induced adipose factor |
FAST kinase domains 2 |
ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN |
||
[FAS-activated serine-threonine kinase domain 2; FAST kinase domains 2]. The gene has been identified independently as KIAA0971. Ghezzi et al (2008) have identified nonsense mutations in FASTKD2 in an infantile mitochondrial encephalomyopathy associated with cytochrome C oxidase deficiency.
FASTKD2 is expressed ubiquitously, most strongly in skeletal muscle. A role in the regulation in mitochondrial apoptosis is suggested by experiments showing that mutant fibroblasts show decreased apoptosis after treatment with staurosporine.
Yeung et al (2011) have reported that knock-down of FASTKD2 expression prevents apoptosis of breast cancer cells elicited by
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |