F cells |
Fc-epsilon-R1-beta |
DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA |
||
These cells in the pancreas produce pancreatic polypeptide and are the same as PP cells (Fiocca et al, 1983).
Note: not to be confused with F cells, which are erythrocytes that continue to express fetal hemoglobin.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |