dFADD |
DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW |
WARYADWLFTTPLLLLDLALLV |
||
[Duffy antigen-erythrocyte chemokine receptor] This designation has been used in publications to refer to DARC [Duffy Antigen Receptor for Chemokines]. Chaudhuri et al (1994) have shown that the Duffy antigen and ECKR are identical.
In the nomenclature of CD antigens this protein has been given the designation CD234.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |