Dark pituicytes |
DARP-36aa |
DC inflammatory protein-1 |
||
[dopamine releasing protein] DARP is a multisubunit glycoprotein involved in the development, recovery, and function of rat catecholaminergic systems as a potent regulator of dopamine release (Chang and Ramirez, 1988; Llano and Ramirez, 1994). DARP-36aa, (DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS), is a peptide derived from the first 36 amino acids at the N-terminal sequence of DARP and shows strong sequence similarity with albumin.
DARP-36aa is one of the neurotrophic factors enhancing neuronal survival and axonal growth. It has been shown to be a selective promoter of cell survival and morphological development of cultured rat mesencephalic neurons (Smith and Ramirez, 2003).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |