CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY |
Cyr-61(234-251) |
Pleurocidin NRC-08 |
||
[Cysteine-rich angiogenic inducer 61, cysteine-rich 61] cyr-61 is a growth factor-inducible immediate-early gene identified initially in mouse 3T3 fibroblasts stimulated by serum, PDGF, FGF, and the tumor promoter 12-O-tetradecanoyl-phorbol-13-acetate. For a peptide derived from cyr-61 that negatively influences angiogenesis see: cyrostatin.
Cyr-61 protein (379 amino acids) is a cysteine-rich heparin binding protein that associates with the cell surface and the extracellular matrix. cyr-61 is a member of the CCN family
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |