Crotalicidin(15-34) |
crotocetin |
CMKAR2 |
||
This peptide with the sequence YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Laure, 1975; Rádis-Baptista G et al, 1999, 2003) has been identified in the venom of Crotalus durissus terrificus (South American rattlesnake).
Crotamine possesses multiple functions (for overview see also: Kerkis et al, 2010). It acts as a potent voltage-gated potassium channel inhibitor (Peigneur et al, 2012) and causes hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism. Crotamine has high specificity for actively proliferating cells and its cytotoxic effects are mediated through lysosomal membrane permeabilization (Hayashi et al, 2008). Nascimento et al (2012) have reported that the peptide targets tumor tissue in vivo and triggers a lethal calcium-dependent pathway in cultured cells.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |