COPE Media Kit


Cope Home
Previous entry:
Crotalicidin(15-34)
Next entry:
crotocetin
Random entry:
CMKAR2
Search COPE:

Crotamine

This peptide with the sequence YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Laure, 1975; Rádis-Baptista G et al, 1999, 2003) has been identified in the venom of Crotalus durissus terrificus (South American rattlesnake).

Crotamine possesses multiple functions (for overview see also: Kerkis et al, 2010). It acts as a potent voltage-gated potassium channel inhibitor (Peigneur et al, 2012) and causes hind limb paralysis, and severe muscle necrosis by a non-enzymatic mechanism. Crotamine has high specificity for actively proliferating cells and its cytotoxic effects are mediated through lysosomal membrane permeabilization (Hayashi et al, 2008). Nascimento et al (2012) have reported that the peptide targets tumor tissue in vivo and triggers a lethal calcium-dependent pathway in cultured cells.

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: March 2017



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=12759