Collagenase |
Collagenase-2 |
GGVTGVTEFEPVDVSGEDYDSDEMDEDGRA |
||
Gene symbol: CLG1. Abbr. also: CL-1. This protein is known also simply as Collagenase, or tissue collagenase, fibroblast-type collagenase (or fibroblast collagenase), and interstitial collagenase. According to a numerical nomenclature this enzyme has been given the designation MMP-1 [matrix metalloproteinase-1].
For other entries pertaining to metalloproteinases see also the Metalloproteinase Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |