Co4 antigen |
coa |
DPFFKVPVNKLAAVSNFGYDLYRVRSSMSPTTNV |
||
The monoclonal antibody of this name recognizes a colorectal antigen that is expressed on many colorectal carcinomas but also on normal epithelial tissues (Herlyn et al, 1979, 1986). In the nomenclature of CD antigens the new designation for the antigen recognized by the CO17-1A monoclonal antibody is CD326.
Ross et al (1986) have reported that the antigen detected by the CO17-1A monoclonal antibody is identical with the GA733-2 antigen
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |