CNPY2 |
CNS organoids |
ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
This glioma cell line (inbred Lewis rat) has been established from an N-nitroso-N-methylurea induced neoplasm in the central nervous system. CNS-1 is a highly invasive tumor. The cells are immunoreactive for glial fibrillary acidic protein, S100 protein, vimentin, neural cell adhesion molecule (NCAM), retinoic acid receptor alpha, intercellular adhesion molecule, and neuron specific enolase (Kruse et al, 1994). The cells are constitutive producers of MCP-1 and TGF-beta (Kielian et al, 2002).
For an overview of other cell lines used in research on cytokines see: Cell lines in Cytokine Research
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |