CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP |
CGP |
anion exchanger 1 |
||
This peptide, subsequently referred to as GX1 peptide, has been identified by Zhi et al (2004) in a phage display screen for peptides that bind selectively to endothelial cells of human gastric cancer rather than non-endothelial cells. This homing peptide binds to the vasculature in xenotransplanted gastric cancer in nude mice and to human umbilical vein endothelial cells (Hui et al, 2008). A fusion protein of CGNSNPKSC with human TNF-alpha has been shown to be bioactive and to reach the tumour site faster than TNF-alpha (Cao et al, 2009). Chen et al (2012) have reported that the peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |