CD86deltaTM |
CD88 |
GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT |
||
[CD87(+), CD87(-)]
Other designations:
MO3 [Monocyte activation antigen MO3]
PLAUR [plasminogen activator urokinase receptor]
UPA-R [urokinase plasminogen activator receptor]
The antigen is expressed on granulocytes, monocytes, macrophages, T-cells after cell activation.
For additional information on CD antigens see also: CD antigens Dictionary.
See remarks in the CD antigens Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |