CD81P3 |
CD83 |
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
[CD82(+), CD82(-)]
Other designations:
KANGAI-1 (from Chinese 'kang ai' = anticancer)
R2 [Inducible membrane protein R2]
ST6 [suppressor of tumorigenicity-6]
For the CD antigen assignment see: Engel and Tedder (1994). CD82 is the approved gene symbol for this protein.
CD82 is a type-3 transmembrane protein and belongs to the tetraspanin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |