CD309 |
CD314 |
APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW |
||
[CD312(+), CD312(-)]
Other designations:
EMR2 [EGF-like module containing mucin-like hormone receptor-like-2]. The approved gene symbol is ADGRE2 [Adhesion G protein-coupled receptor E2].
The cDNA encoding EMR2 has been identified by Lin et al (2000). EMR2 is a protein of 823 amino acids and has multiple splice variants. Chiu et al (2008) have reported that EMR2 in human leukocytes can undergo trans-splicing. This gives rise to a chimeric molecule that contains the EGF-like motif 3 of CD97 and is functional in ligand binding like the parent molecules and may be a strategy employed by leukocytes
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |