CCB peptide |
CC-Chemokine-activated killer |
ATCDLLSGIGVQHSACALHCVFRGNRGGYCTGKGICVCRN |
||
This term has multiple meanings:
_____________________________________________________________________________
(-1-) cell cycle centrosome associated
This is a databank synonym for a centrosomal protein that has been described as mouse CCD41 and is identical with EPCR [endothelial protein C receptor].
In the nomenclature of CD antigens this protein has been given the designation CD201.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |