BTG2 |
B-TGF |
QGDGEDPCQIVRCSYGANCIAYGDTAICECPFGYSGIRCQDPS |
||
[B-cell translocation gene-3; BTG family member 3] The BTG3 gene (see also BTG family) codes for a 30 kDa protein involved in the regulation of cell growth and cell differentiation. BTG3 is expressed in most adult murine and human tissues analyzed (Guehenneux et al, 1997).
BTG3 has been isolated independently as human and mouse ANA [Abundant in Neuroepithelium Area], which encodes a protein of 252 amino acids. The amino-terminal half of ANA is homologous to previously characterized antiproliferative gene products, BTG1, BTG2, and Tob.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |