BRF |
BRF2 |
MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK |
||
[Butyrate response factor 1] is a zinc finger protein that has been identified through genetic screening aimed at identifying proteins that mediate rapid decay of various cytokine mRNAs including IL3, IL6, GM-CSF and TNF-alpha (Stoecklin et al, 2001, 2002). BRF1 acts as a destabilizer of short-lived mRNAs containing AU-rich elements. BRF1 contains protein domains that allow recruitment and activation of mRNA decay enzymes (Lykke-Andersen J and Wagner E, 2005). BRF1 is a member of the CCCH tandem zinc finger protein family. Other members are TTP [tristetraprolin, BRF2 [Butyrate response factor 2] (zfp36L2
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |