B-LPF |
blr-1 |
EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF |
||
[Bronchial leukocyte proteinase inhibitor] BLPI is a protein of 11 kDa found in human mucous secretions (Smith and Johnson, 1985). It controls the serine proteinases elastase and cathepsin G, which are released from extravascular polymorphonuclear leukocytes. Sequence analysis shows that the protein is identical with SLPI [secretory leukocyte protease inhibitor] (Fritz, 1988).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |