BCLb |
BCLgL |
AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL |
||
[BCLgonad] The cDNA for this protein has been isolated by Guo et al (2001), following a search in EST databanks for sequences with homology to the anti-apoptotic protein BCL2. The approved gene symbol is BCL2L14 [BCL2-like-14].
There is a short (BCLgS; 252 amino acids) and a long (BCLgL; 327 amino acids) variant. Both proteins contain a candidate BH3 domain. The long variant contans a BH2 domain. Strong expression of the long variant is seen in lung, pancreas, prostate, and testis. The short form appears to be expressed only in testis.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |