Attacin F |
ATTAC mouse |
VSCNGVCSPFEMPPCGSSACRCIPYGLVVGNCRHPSG |
||
Attacin A, Attacin B, Attacin C, Attacin D, Attacin E, and Attacin F, constitute a family of closely related antibacterial proteins isolated from the hemolymph of immunized pupae of the Cecropia moth (giant silk moth), Hyalophora cecropia (Hultmark et al, 1983; Engstrom et al, 1984; Kockum et al, 1984; Boman et al, 1985; Sun et al, 1991). Attacin F has been shown to be derived by proteolysis from the native protein, Attacin E (Engstrom et al, 1984).
Some Attacin or Attacin-related proteins have been isolated also from Drosophila melanogaster
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |