Angiopeptin |
Angiopoietin-2 |
SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG |
||
abbr. Ang-1, ANGPT1. This factor was found in the conditioned medium of the human neuroepithelioma cell line SHEP1 and the mouse myoblast cell line C2C12ras. The cDNA encoding a protein of 498 amino acids was isolated by using a secretion-trap expression cloning procedure exploiting the presence of a signal sequence present in growth factors that are secreted by producer cells (Davis et al, 1996). Murine and human factors show 97 % identity at the amino acid level. The cDNA encoding angiopoietin-1 has been identified independently as
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |