Amurin-3 |
AMV-IAP |
60 kDa TNF-alpha receptor |
||
The genes encoding the precursors of
Amurin-1 (GLWESIKNLGKKFALNIMEKLKCKFGGGCLP),
Amurin-2 (FLSLALAALPKLFCLIFKKC), and
Amurin-3 (ILPILSLIGGLL) have been cloned from dried skin of the Heilongjiang brown frog, Rana amurensis. These peptides are thought to possess antibacterial properties and may play a role in innate immunity (Zhou et al, 2006).
Zhang L et al (2018) have reported highly-conserved variants, Amurin-2a, Amurin-2b and Amurin-2c. The mature Amurin-2c has the same amino acid sequence as one of the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |