Alpha-1-acid glycoprotein |
Alpha-1-acid glycoprotein 2 |
GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS |
||
abbr. AGP or AGP1 [alpha-1-AGP]. Approved gene symbol ORM1 [orosomucoid 1])
This protein has been identified originally as orosomucoid (abbr. ORM), one of the mucoproteins of human plasma (Weimer et al, 1950; Weimer and Winzler, 1955). Alpha-1-acid glycoprotein 1 is a highly polymorphic serum protein encoded by two closely related tandemly arranged genes (Dente et al, 1985; Webb et al, 1988). These two genes are called ORM1 [orosomucoid 1] and ORM2 [orosomucoid 2] (Eap et al, 1988) or AGP1 and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |