AVP type 2 |
AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN |
VVYPWTQ |
||
This peptide corresponds to casein-beta(177-183). See also: casein-derived iron-chelating peptides.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |