ATP6 accessory protein 2 |
ATPase H+ transporting accessory protein 2 |
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
||
[H(+) transporting lysosomal ATPase V0 subunit A2] Other designations are A2V-ATPase, V-ATPase 116 kDa isoform a2 [V-type proton ATPase 116 kDa subunit a isoform 2], Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2, Lysosomal H(+)-transporting ATPase V0 subunit a2, A2V-ATPase [H(+) transporting lysosomal ATPase V0 subunit A2].
The multisubunit vacuolar-type ATPase (called also V-ATPase [vacuolar-type proton pump H(+)-ATPase]) is essential for the acidification of endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |