Anterophin |
Antheraea lysozyme-like protein 1 |
GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK |
||
[ANTH domains]
[AP180 amino-terminal homology domain] AP180 [assembly protein 180 kDa) (approved gene symbol: SNAP91; synaptosomal-associated protein, 91kDa] is an endocytotic accessory proteins that has been implicated in the formation of clathrin-coated pits (Duncan and Payne, 2003). The ANTH domain is an N-terminal domain that binds phosphatidylinositol-4,5-bisphosphate in the membrane. This N-terminal domain is homologous to the ENTH domain (De Camilli et al, 2002) but is extended by one or more alpha-helices when compared with the ENTH domain (Ford et al, 2001). The ANTH domain acts as a membrane targeting domain (Stahelin et al, 2003). Proteins containing this domain
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |