AANFGPSVFTPEVHETWQKFLNVVVAALGKQYE |
AAP-1 |
CD8(-) conventional dendritic cells |
||
[Alanyl aminopeptidase] abbr. and approved gene symbol: ANPEP. An older designation is PEPN [aminopeptidase N]. This enzyme (EC3.4.11.2) catalyzes the sequential removal of amino acids from the aminotermini of polypeptide chains. The enzyme is the same as aminopeptidase N (Look et al, 1986, 1989).
In the nomenclature of CD antigens this protein has been given the designation CD13.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |