40S ribosomal protein S19 |
40S ribosomal protein S23 |
VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY |
||
abbr. RPS21. See: ribosomal protein S21.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |